(data stored in ACNUC7421 zone)

EMBL: AP010803.PE14

AP010803.PE14        Location/Qualifiers
FT   CDS             complement(8578..11343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00140"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94848"
FT                   /db_xref="GOA:D4YWW6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW6"
FT                   /protein_id="BAI94848.1"
FT                   /translation="MKKSLWLISVGAIALGSSVPVAWAQDSGSAVDSENVNIIVTATRR
FT                   ASPLSDVPIAVSAVTSQAMQNSGATDIRALNQLAPSLLLSSTGTEANASARIRGIGTVG
FT                   DNPGLESSVAVFIDGVYRSRTGAGLNELGEIERVEVLRGPQGTLFGRNASAGLINIISK
FT                   APEFTLGGKAEVTYGNYDYWRLAGRVTGPVTDKLALSLDGVWSKRDGFYDLVNASGAKV
FT                   GETNDRDRYFLRGQALFQPNDALSIRLIGDYTHRDESCCGAPYIETRERRPVAGGGYST
FT                   APFNRIAAILAGQGSVFGADPYDRDLTITAGRNYVSKLKDWGVSGEINYDLGGTKLTSI
FT                   TAYRHYKSQDYGDYDYGGADLLYRDPNTHRQFKTFTQELRAQGSAFNDVLDWLVGGYYA
FT                   HEKLTLEDNIVFGADYGRFAACRLMAGASVNSNLTAAQLAACGSGLATQALITGTQAQL
FT                   NAGLILAGVPALQAGAISTGLGNGLRALAAIPSGTGDVASLYHQKSENWALFTHNIVHI
FT                   TSQLDLTLGLRYTHESKRFSADFNNNNATCAALQASSLPAIATNAQLGSAAALAGGILT
FT                   LGCLGNGSTGLNALDLNDKISDGEFSGTAVLSWKPIQELLVYGSYSKGYKAGGYNLDRF
FT                   QLGSTGLNAVPAVFAPRTNADVTSLRFAAEKVDAFEVGLKYTQPKWSANIAAFRQEFKN
FT                   FQLNTFNGTSFVVQNINGCDGALTAARTCAGGDVGPGLISQGVELELSATPARNVRVAG
FT                   GFTYARAKFANRLVGSSNGTVPLDPALFLLPGSINSQAPEVVTTVSAAWTPSLGSNGLS
FT                   ALFYVDGRMSSDFNTGSDLFPEKRQDGYAVFNARVGIRGPQQRWAVEFWGQNIFNQDYS
FT                   QVAFSTPLQSSSPSTSTTGQFALGAPMANQLISAYLAEPRTYGITLRGSF"
     MKKSLWLISV GAIALGSSVP VAWAQDSGSA VDSENVNIIV TATRRASPLS DVPIAVSAVT        60
     SQAMQNSGAT DIRALNQLAP SLLLSSTGTE ANASARIRGI GTVGDNPGLE SSVAVFIDGV       120
     YRSRTGAGLN ELGEIERVEV LRGPQGTLFG RNASAGLINI ISKAPEFTLG GKAEVTYGNY       180
     DYWRLAGRVT GPVTDKLALS LDGVWSKRDG FYDLVNASGA KVGETNDRDR YFLRGQALFQ       240
     PNDALSIRLI GDYTHRDESC CGAPYIETRE RRPVAGGGYS TAPFNRIAAI LAGQGSVFGA       300
     DPYDRDLTIT AGRNYVSKLK DWGVSGEINY DLGGTKLTSI TAYRHYKSQD YGDYDYGGAD       360
     LLYRDPNTHR QFKTFTQELR AQGSAFNDVL DWLVGGYYAH EKLTLEDNIV FGADYGRFAA       420
     CRLMAGASVN SNLTAAQLAA CGSGLATQAL ITGTQAQLNA GLILAGVPAL QAGAISTGLG       480
     NGLRALAAIP SGTGDVASLY HQKSENWALF THNIVHITSQ LDLTLGLRYT HESKRFSADF       540
     NNNNATCAAL QASSLPAIAT NAQLGSAAAL AGGILTLGCL GNGSTGLNAL DLNDKISDGE       600
     FSGTAVLSWK PIQELLVYGS YSKGYKAGGY NLDRFQLGST GLNAVPAVFA PRTNADVTSL       660
     RFAAEKVDAF EVGLKYTQPK WSANIAAFRQ EFKNFQLNTF NGTSFVVQNI NGCDGALTAA       720
     RTCAGGDVGP GLISQGVELE LSATPARNVR VAGGFTYARA KFANRLVGSS NGTVPLDPAL       780
     FLLPGSINSQ APEVVTTVSA AWTPSLGSNG LSALFYVDGR MSSDFNTGSD LFPEKRQDGY       840
     AVFNARVGIR GPQQRWAVEF WGQNIFNQDY SQVAFSTPLQ SSSPSTSTTG QFALGAPMAN       900
     QLISAYLAEP RTYGITLRGS F                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page