(data stored in ACNUC7421 zone)

EMBL: AP010803.PE142

AP010803.PE142       Location/Qualifiers
FT   CDS             complement(145988..146218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94976"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX94"
FT                   /protein_id="BAI94976.1"
FT                   /translation="MPVGACICPPIKSSRFLGGLNRLSDLMESDFCAGRIRSARRLPRR
FT                   CKLQLWPGHASRNQRGRKPENGQVRRASSIP"
     MPVGACICPP IKSSRFLGGL NRLSDLMESD FCAGRIRSAR RLPRRCKLQL WPGHASRNQR        60
     GRKPENGQVR RASSIP                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page