(data stored in ACNUC7421 zone)

EMBL: AP010803.PE149

AP010803.PE149       Location/Qualifiers
FT   CDS             154790..155506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94983"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA1"
FT                   /protein_id="BAI94983.1"
FT                   /translation="MNKLIADAIDAHGGWERWEALKSVQVDVVTGGELLDRKTAPGSGT
FT                   LRITAKTQRQECRMGPIDGDMITILEPGRVAIETADGTLVAERHDPRAAFNGHELDTPW
FT                   DPLHRTYFGCYAMWSYLTVPFSLAMPGVQVWDIDPLEEDGELWQGVRVVMPDEIATHSR
FT                   AQEFYFGDDMLIRRQDYTLDIAGGHRIANYALDIVSVDGLKFASKRRAYMCNKKYEVLR
FT                   DRLLIRLDLSNFQLIA"
     MNKLIADAID AHGGWERWEA LKSVQVDVVT GGELLDRKTA PGSGTLRITA KTQRQECRMG        60
     PIDGDMITIL EPGRVAIETA DGTLVAERHD PRAAFNGHEL DTPWDPLHRT YFGCYAMWSY       120
     LTVPFSLAMP GVQVWDIDPL EEDGELWQGV RVVMPDEIAT HSRAQEFYFG DDMLIRRQDY       180
     TLDIAGGHRI ANYALDIVSV DGLKFASKRR AYMCNKKYEV LRDRLLIRLD LSNFQLIA         238
//

If you have problems or comments...

PBIL Back to PBIL home page