(data stored in ACNUC7421 zone)

EMBL: AP010803.PE150

AP010803.PE150       Location/Qualifiers
FT   CDS             complement(155644..157224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94984"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA2"
FT                   /protein_id="BAI94984.1"
FT                   /translation="MFFAGLIMSEWLSQPVTDFRGRPLAEPGTPAGYAALIERYGLRLP
FT                   LPARLAAIAERHHPRSTAEWQMMTPRHMPDATLIGHLTFAFRYEGIDLSILAQLFRAEE
FT                   PAAFARIVRDAPTGSFARRIWFLYEWMTGDRLDVPDAGKVRLVPVVDTRLQLALADGVA
FT                   SPRHRVANNLPGTPRYCPMVRRTDAILAYEAQAFDERARAVVGRIRADLVARAAAFLLL
FT                   NDSKSSFAIEGEKPSGTRAARWGQAIAEAGSRPLSLAEFDRLQRIVIGDQRFVRLGLRE
FT                   EGGFVGVHHRETGLPVPDHVSARESDLRDLVEGLVAYSARAVAGGMDPVAAAAVLAFGF
FT                   VYIHPYVDGNGRLHRWLFHHVLASARFNPPGMVFPISAVILRRIDAYKGTLTSYSGPLL
FT                   PFIEWEPTPEGNVRVLNDTADFYRFFDATAHVEFLYACVQQTIEEDLPREARFLEAFDS
FT                   FNEAVQQIVDMPTAQVELLLKFLEQNEGRLSQPARSREFEALTPAEVEQVEAVYADAFG
FT                   PEKVNPHKP"
     MFFAGLIMSE WLSQPVTDFR GRPLAEPGTP AGYAALIERY GLRLPLPARL AAIAERHHPR        60
     STAEWQMMTP RHMPDATLIG HLTFAFRYEG IDLSILAQLF RAEEPAAFAR IVRDAPTGSF       120
     ARRIWFLYEW MTGDRLDVPD AGKVRLVPVV DTRLQLALAD GVASPRHRVA NNLPGTPRYC       180
     PMVRRTDAIL AYEAQAFDER ARAVVGRIRA DLVARAAAFL LLNDSKSSFA IEGEKPSGTR       240
     AARWGQAIAE AGSRPLSLAE FDRLQRIVIG DQRFVRLGLR EEGGFVGVHH RETGLPVPDH       300
     VSARESDLRD LVEGLVAYSA RAVAGGMDPV AAAAVLAFGF VYIHPYVDGN GRLHRWLFHH       360
     VLASARFNPP GMVFPISAVI LRRIDAYKGT LTSYSGPLLP FIEWEPTPEG NVRVLNDTAD       420
     FYRFFDATAH VEFLYACVQQ TIEEDLPREA RFLEAFDSFN EAVQQIVDMP TAQVELLLKF       480
     LEQNEGRLSQ PARSREFEAL TPAEVEQVEA VYADAFGPEK VNPHKP                      526
//

If you have problems or comments...

PBIL Back to PBIL home page