(data stored in ACNUC7421 zone)

EMBL: AP010803.PE151

AP010803.PE151       Location/Qualifiers
FT   CDS             157849..158019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94985"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA3"
FT                   /protein_id="BAI94985.1"
FT                   /translation="MRRKMQFDYGRAMTNGQDERKERLAQALRDNLRRRKAQSRESRDA
FT                   ENPRRPDDAKG"
     MRRKMQFDYG RAMTNGQDER KERLAQALRD NLRRRKAQSR ESRDAENPRR PDDAKG            56
//

If you have problems or comments...

PBIL Back to PBIL home page