(data stored in ACNUC7421 zone)

EMBL: AP010803.PE155

AP010803.PE155       Location/Qualifiers
FT   CDS             complement(162534..163514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="SJA_C1-01550"
FT                   /product="tellurite resistance protein TerC"
FT                   /note="membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94989"
FT                   /db_xref="GOA:D4YXA7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA7"
FT                   /protein_id="BAI94989.1"
FT                   /translation="MEFLFADWLGTPAWFWLAFFSIVVALTAFDLGFLHKENKEIGIRE
FT                   SLKLSIFYIGIACAFGAWVWFVRGPEPGMQYFTGFFIEKALSIDNVFVISLIFTYFAIP
FT                   AKYQYRALLWGIIGVIVLRGLMIAGGAMLLHQAYWVLYLFAAFLIFTGIRMMFAGDEPM
FT                   DVGKNPLIRFISKHMRVTPEQHGEHFLARMTDPKTGKVVMAATPLLLALVVINFADLVF
FT                   AVDSVPAIFAITTDMFIVYTSNVMAILGLRALYFALAAMVHRFHYLKYALAAILVFIGA
FT                   KIFVADFVMDGGKFPPVISLGVTFALIGVGVGWSLWKTRGEEKLA"
     MEFLFADWLG TPAWFWLAFF SIVVALTAFD LGFLHKENKE IGIRESLKLS IFYIGIACAF        60
     GAWVWFVRGP EPGMQYFTGF FIEKALSIDN VFVISLIFTY FAIPAKYQYR ALLWGIIGVI       120
     VLRGLMIAGG AMLLHQAYWV LYLFAAFLIF TGIRMMFAGD EPMDVGKNPL IRFISKHMRV       180
     TPEQHGEHFL ARMTDPKTGK VVMAATPLLL ALVVINFADL VFAVDSVPAI FAITTDMFIV       240
     YTSNVMAILG LRALYFALAA MVHRFHYLKY ALAAILVFIG AKIFVADFVM DGGKFPPVIS       300
     LGVTFALIGV GVGWSLWKTR GEEKLA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page