(data stored in ACNUC7421 zone)

EMBL: AP010803.PE159

AP010803.PE159       Location/Qualifiers
FT   CDS             complement(167646..168227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01590"
FT                   /product="putative nucleotide-binding protein"
FT                   /note="putative Rossmann fold nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94993"
FT                   /db_xref="GOA:D4YXB1"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB1"
FT                   /protein_id="BAI94993.1"
FT                   /translation="MKRLAVYCGSATPADPAYVDAARHVGRVLARRGIGVVYGGGRLGL
FT                   MGAVADAALEAGGEVIGVIPEALVGAEVAHRGCTELRVVQTMHQRKQLFTDLSDGFVTL
FT                   PGGVGTMDELWEAISWAQLGYHQKPVGLLNVAGFYDQLIAFNQHMVEAGFIRAQHANIL
FT                   IHANAVEALLDRMAAYQPHETVFAMKADRL"
     MKRLAVYCGS ATPADPAYVD AARHVGRVLA RRGIGVVYGG GRLGLMGAVA DAALEAGGEV        60
     IGVIPEALVG AEVAHRGCTE LRVVQTMHQR KQLFTDLSDG FVTLPGGVGT MDELWEAISW       120
     AQLGYHQKPV GLLNVAGFYD QLIAFNQHMV EAGFIRAQHA NILIHANAVE ALLDRMAAYQ       180
     PHETVFAMKA DRL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page