(data stored in SCRATCH zone)

EMBL: AP010803.PE162

AP010803.PE162       Location/Qualifiers
FT   CDS             170929..171081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94996"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB4"
FT                   /protein_id="BAI94996.1"
FT                   /translation="MPHRPTPHPATQRQYSMGGRVGEWAGAAPKMYICAFSKQTLRGFA
FT                   RKCTD"
     MPHRPTPHPA TQRQYSMGGR VGEWAGAAPK MYICAFSKQT LRGFARKCTD                   50
//

If you have problems or comments...

PBIL Back to PBIL home page