(data stored in ACNUC7421 zone)

EMBL: AP010803.PE163

AP010803.PE163       Location/Qualifiers
FT   CDS             171115..171387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01630"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94997"
FT                   /db_xref="GOA:D4YXB5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB5"
FT                   /protein_id="BAI94997.1"
FT                   /translation="MHIVADRDKLLARVRRIAGQIGAVERQLAGDAGCSETLQLVASVR
FT                   GAVGSLMEELIDQHMREHVARPGISDAARQAAAEEMLALIRRYGK"
     MHIVADRDKL LARVRRIAGQ IGAVERQLAG DAGCSETLQL VASVRGAVGS LMEELIDQHM        60
     REHVARPGIS DAARQAAAEE MLALIRRYGK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page