(data stored in ACNUC7421 zone)

EMBL: AP010803.PE164

AP010803.PE164       Location/Qualifiers
FT   CDS             171384..172370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01640"
FT                   /product="CDF-family cation efflux system protein"
FT                   /note="Co/Zn/Cd efflux system component / putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94998"
FT                   /db_xref="GOA:D4YXB6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB6"
FT                   /protein_id="BAI94998.1"
FT                   /translation="MSMHDDHDHGHHPEEHDHARAMPATGADDGEESHYFDHIYLSRGH
FT                   DENARKTMWVVWLTAATMVVEIVFGWLSGSMALLADGFHMATHAGALAVAAAAYGYARR
FT                   HARNPRYTFGTGKVGDLSGFASALILAFTALFIAVESAMRLFDPVQVAFGEATLVAVIG
FT                   LVINLISALLLGHDHSHDHGHHGHAHDHKQGHADNNLRAAYMHVLTDALTSVLAITALL
FT                   AGRYMGWWWLDPAVGLLGAAVIARWAWGLMKDTAAILLDTAEPALTARIKGLVEAEGAT
FT                   IRDLHVWRIGPHAHAAIVSLAPGADAAAVRRQVRALPRMEHVTVECG"
     MSMHDDHDHG HHPEEHDHAR AMPATGADDG EESHYFDHIY LSRGHDENAR KTMWVVWLTA        60
     ATMVVEIVFG WLSGSMALLA DGFHMATHAG ALAVAAAAYG YARRHARNPR YTFGTGKVGD       120
     LSGFASALIL AFTALFIAVE SAMRLFDPVQ VAFGEATLVA VIGLVINLIS ALLLGHDHSH       180
     DHGHHGHAHD HKQGHADNNL RAAYMHVLTD ALTSVLAITA LLAGRYMGWW WLDPAVGLLG       240
     AAVIARWAWG LMKDTAAILL DTAEPALTAR IKGLVEAEGA TIRDLHVWRI GPHAHAAIVS       300
     LAPGADAAAV RRQVRALPRM EHVTVECG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page