(data stored in ACNUC7421 zone)

EMBL: AP010803.PE166

AP010803.PE166       Location/Qualifiers
FT   CDS             complement(173749..174177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01660"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95000"
FT                   /db_xref="GOA:D4YXB8"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXB8"
FT                   /protein_id="BAI95000.1"
FT                   /translation="MFRQLTKSLYVSPQISVDQVAEAKALGVTVIINNRPDDEEPGQTN
FT                   GAEIEAAAKAAGIAYAAVPVAHGGFSPWQLDGMAAALEQAGEGKILAYCRSGTRSTLLW
FT                   ALTRARAGDHPAALAEQAASAGYDVAPVRQIMDALAAG"
     MFRQLTKSLY VSPQISVDQV AEAKALGVTV IINNRPDDEE PGQTNGAEIE AAAKAAGIAY        60
     AAVPVAHGGF SPWQLDGMAA ALEQAGEGKI LAYCRSGTRS TLLWALTRAR AGDHPAALAE       120
     QAASAGYDVA PVRQIMDALA AG                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page