(data stored in ACNUC7421 zone)

EMBL: AP010803.PE168

AP010803.PE168       Location/Qualifiers
FT   CDS             complement(176481..176795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95002"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC0"
FT                   /protein_id="BAI95002.1"
FT                   /translation="MSGRRKWIYGALAAVLLPLALLAWNWSALRAQAQVGAGFGARVTC
FT                   SCRYVEGRSMESCKGDKEPGMWAVSLKDLPESQSVNAAVPLLASRTARYRKGWGCLLDP
FT                   "
     MSGRRKWIYG ALAAVLLPLA LLAWNWSALR AQAQVGAGFG ARVTCSCRYV EGRSMESCKG        60
     DKEPGMWAVS LKDLPESQSV NAAVPLLASR TARYRKGWGC LLDP                        104
//

If you have problems or comments...

PBIL Back to PBIL home page