(data stored in ACNUC7421 zone)

EMBL: AP010803.PE169

AP010803.PE169       Location/Qualifiers
FT   CDS             176834..177958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01690"
FT                   /product="putative beta-lactamase class C"
FT                   /EC_number="3.5.1.46"
FT                   /note="penicillin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95003"
FT                   /db_xref="GOA:D4YXC1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC1"
FT                   /protein_id="BAI95003.1"
FT                   /translation="MRLERNSVKRLGALGGILAVLAVAGLWTVRAAAGPEPVYHVAGDS
FT                   DADAATLRAAIDPLFDDAVGETRALVIMHDGEIVAERYAPGYGPRTKLPSWSAAKSVTA
FT                   VLIGLMVSDGRLALDSPVPVAAWGQPGDPRGRITLRQLLAMTSGLDHVEDAEPLAEADT
FT                   IRMLFTDGAQDMGAFAEAKPLAHAPGAAFSYSTGNSVILADLMARMLTNSTDPDVRRRA
FT                   MQMFIDGRLKIPARLDSLTVEYDAAGTMIGGSFMHMTARDYARFGELLRNHGRGAAGHQ
FT                   IVPEKWIDHMREPSPRNAAYGAHLWLNRDSEDSALMPGRAPRSLFGCVGHGGQYILVSP
FT                   SQRLTVVRLGMSPRKEERAALKAELAKLVGLYAR"
     MRLERNSVKR LGALGGILAV LAVAGLWTVR AAAGPEPVYH VAGDSDADAA TLRAAIDPLF        60
     DDAVGETRAL VIMHDGEIVA ERYAPGYGPR TKLPSWSAAK SVTAVLIGLM VSDGRLALDS       120
     PVPVAAWGQP GDPRGRITLR QLLAMTSGLD HVEDAEPLAE ADTIRMLFTD GAQDMGAFAE       180
     AKPLAHAPGA AFSYSTGNSV ILADLMARML TNSTDPDVRR RAMQMFIDGR LKIPARLDSL       240
     TVEYDAAGTM IGGSFMHMTA RDYARFGELL RNHGRGAAGH QIVPEKWIDH MREPSPRNAA       300
     YGAHLWLNRD SEDSALMPGR APRSLFGCVG HGGQYILVSP SQRLTVVRLG MSPRKEERAA       360
     LKAELAKLVG LYAR                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page