(data stored in ACNUC7421 zone)

EMBL: AP010803.PE171

AP010803.PE171       Location/Qualifiers
FT   CDS             complement(179033..180811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01710"
FT                   /product="TrkA domain protein"
FT                   /note="sodium/sulfate symporter / di- and tricarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95005"
FT                   /db_xref="GOA:D4YXC3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC3"
FT                   /protein_id="BAI95005.1"
FT                   /translation="MHFITALIGIYRAEIGLVILALMFVAFVRERYSPTVVSVVGACAF
FT                   ALLGLLDEKDLFSVFSNSAPLTVGAMFVLSGALIRTGTINRVADLVMARAQRHPRLALA
FT                   EVTLGTVVLSAFLNNTPVVILLIPIMFKLAQATGYPVKKLLIPMNAVAVMGGCVTLIGT
FT                   STNLIVAGIAADQGMAPFGIFDITPYGLAGVAAGIAALAGLSFLLPSDPPSIAGEDGGN
FT                   VQDYLTELILSRDSDLIGRTVGSLSIFGRSASLLGLKRAGEIRRRGIEEEELHAGDHLL
FT                   VHADGATIMTLRESGDFEIGLAAASETPGGGTVIEAMIAPSHPSIGERLIDIPFLHALR
FT                   VRIIGIHRARHLPGPDLSETRVRGADRLLIAGSDDSIRSLKDNAHLIGVDISRARAFRP
FT                   RKAWIAILALTAVVLLSAIDVIGIGLAAFIAVGVILVTRCIDPEEAWAAIDGDVLILIF
FT                   AMLAVGLALEQAGSVALMVGWIDPLLAAAPAWSLVFLIYFFALLLSELLSNNAVAALLT
FT                   PLTIALAHQLGADPRPLVIALMIGASACFATPIGYQTNALVYAAGDYRFSDFVRIGIPL
FT                   NLVVGLAVCTALVLLG"
     MHFITALIGI YRAEIGLVIL ALMFVAFVRE RYSPTVVSVV GACAFALLGL LDEKDLFSVF        60
     SNSAPLTVGA MFVLSGALIR TGTINRVADL VMARAQRHPR LALAEVTLGT VVLSAFLNNT       120
     PVVILLIPIM FKLAQATGYP VKKLLIPMNA VAVMGGCVTL IGTSTNLIVA GIAADQGMAP       180
     FGIFDITPYG LAGVAAGIAA LAGLSFLLPS DPPSIAGEDG GNVQDYLTEL ILSRDSDLIG       240
     RTVGSLSIFG RSASLLGLKR AGEIRRRGIE EEELHAGDHL LVHADGATIM TLRESGDFEI       300
     GLAAASETPG GGTVIEAMIA PSHPSIGERL IDIPFLHALR VRIIGIHRAR HLPGPDLSET       360
     RVRGADRLLI AGSDDSIRSL KDNAHLIGVD ISRARAFRPR KAWIAILALT AVVLLSAIDV       420
     IGIGLAAFIA VGVILVTRCI DPEEAWAAID GDVLILIFAM LAVGLALEQA GSVALMVGWI       480
     DPLLAAAPAW SLVFLIYFFA LLLSELLSNN AVAALLTPLT IALAHQLGAD PRPLVIALMI       540
     GASACFATPI GYQTNALVYA AGDYRFSDFV RIGIPLNLVV GLAVCTALVL LG               592
//

If you have problems or comments...

PBIL Back to PBIL home page