(data stored in ACNUC7421 zone)

EMBL: AP010803.PE172

AP010803.PE172       Location/Qualifiers
FT   CDS             180806..180940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95006"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC4"
FT                   /protein_id="BAI95006.1"
FT                   /translation="MHASCAPDRVFASCFNEMGQPWLHGWPVFAAEGDVLTVNPCGAW"
     MHASCAPDRV FASCFNEMGQ PWLHGWPVFA AEGDVLTVNP CGAW                         44
//

If you have problems or comments...

PBIL Back to PBIL home page