(data stored in ACNUC7421 zone)

EMBL: AP010803.PE175

AP010803.PE175       Location/Qualifiers
FT   CDS             complement(183162..184133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01750"
FT                   /product="putative ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95009"
FT                   /db_xref="GOA:D4YXC7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC7"
FT                   /protein_id="BAI95009.1"
FT                   /translation="MPHPSPLSPESRRKHIAEEARTKFHRQIARVRPGSHAFEIAKRVA
FT                   VGTYNDGFIHAGNLAYLSLMTLFPFFIVAAAVASIFGRSQDGLAAVGAFLETVPPGVAE
FT                   VVRQPIVDVLNARTGPLLWLGGLVGLWTVGSLIETIRDILRRAYGTRSTRPFWHYRLTA
FT                   IGITLVSVFAVMFAFSMQVIITGIDQFLHQILPFADQAIQIVSLTKLAPMAILCVALYY
FT                   LYVSLTPSLYKDPRFPKWPGAIATALWWYGVTLLLPVTLSMLGGYDMTYGSLAGVMITL
FT                   IFFFLVGLGVVIGAELNAALAEFPEEEAAAAAQVDKGNGTTV"
     MPHPSPLSPE SRRKHIAEEA RTKFHRQIAR VRPGSHAFEI AKRVAVGTYN DGFIHAGNLA        60
     YLSLMTLFPF FIVAAAVASI FGRSQDGLAA VGAFLETVPP GVAEVVRQPI VDVLNARTGP       120
     LLWLGGLVGL WTVGSLIETI RDILRRAYGT RSTRPFWHYR LTAIGITLVS VFAVMFAFSM       180
     QVIITGIDQF LHQILPFADQ AIQIVSLTKL APMAILCVAL YYLYVSLTPS LYKDPRFPKW       240
     PGAIATALWW YGVTLLLPVT LSMLGGYDMT YGSLAGVMIT LIFFFLVGLG VVIGAELNAA       300
     LAEFPEEEAA AAAQVDKGNG TTV                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page