(data stored in ACNUC7421 zone)

EMBL: AP010803.PE178

AP010803.PE178       Location/Qualifiers
FT   CDS             185958..187289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01780"
FT                   /product="dicarboxylate/amino acid:cation (Na+ or H+)
FT                   symporter"
FT                   /note="DAACS family / Na+/H+-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95012"
FT                   /db_xref="GOA:D4YXD0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD0"
FT                   /protein_id="BAI95012.1"
FT                   /translation="MRNRLTAFILTGMVLGVIVGFATNIWVGGDKALAKDVAGYYHLLA
FT                   DIFLHLIKMIIAPLVFSTLVAGIAHMGDSAALGRIGGRALAWFIIASLISLTLGLIFVN
FT                   FFAPGEGLNLVRSGADSGVNTEALNFRDFILHVFPTSMVGAMAENSILQIVVFSLFVGI
FT                   ALTAIGERGKPIVTVIEAMVELMLQVTGYVMRVAPFAVFGALASVVTTEGLGVLKTFGE
FT                   LVGEFYLSLIALWVLLFAAGSIFLGRRMVKLIRYVREPILIAFSTASSEAAYPKMLEQL
FT                   DRFGVPRRIYSFVLPLGYSFNLDGSMMYSTFATIFIAQAYGIDLPIATQITILLVLMVT
FT                   SKGIAAVPRASLVVVAATLGQFDLPVEGVAFILAVDHFMDMGRTATNVLGNAIATSVIT
FT                   KWEGMLEVEEPEYVPHPKAPAHTPSHGRAGLELASDMVEEEKRG"
     MRNRLTAFIL TGMVLGVIVG FATNIWVGGD KALAKDVAGY YHLLADIFLH LIKMIIAPLV        60
     FSTLVAGIAH MGDSAALGRI GGRALAWFII ASLISLTLGL IFVNFFAPGE GLNLVRSGAD       120
     SGVNTEALNF RDFILHVFPT SMVGAMAENS ILQIVVFSLF VGIALTAIGE RGKPIVTVIE       180
     AMVELMLQVT GYVMRVAPFA VFGALASVVT TEGLGVLKTF GELVGEFYLS LIALWVLLFA       240
     AGSIFLGRRM VKLIRYVREP ILIAFSTASS EAAYPKMLEQ LDRFGVPRRI YSFVLPLGYS       300
     FNLDGSMMYS TFATIFIAQA YGIDLPIATQ ITILLVLMVT SKGIAAVPRA SLVVVAATLG       360
     QFDLPVEGVA FILAVDHFMD MGRTATNVLG NAIATSVITK WEGMLEVEEP EYVPHPKAPA       420
     HTPSHGRAGL ELASDMVEEE KRG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page