(data stored in ACNUC7421 zone)

EMBL: AP010803.PE182

AP010803.PE182       Location/Qualifiers
FT   CDS             190052..190483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95016"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD4"
FT                   /protein_id="BAI95016.1"
FT                   /translation="MAKADQIEVGLRIIIEQPVIGVLHSLQAKDDRPLDPKASGTGEPL
FT                   SFDLPIRIAPGPRFFGDQVRREGPVRRFIYIRIGQLAGDPPSPWSRRMKIDIHDLDEDL
FT                   LTRAIEGRGIIEIVVNGTGKDGTPACATVPPVCRRLSES"
     MAKADQIEVG LRIIIEQPVI GVLHSLQAKD DRPLDPKASG TGEPLSFDLP IRIAPGPRFF        60
     GDQVRREGPV RRFIYIRIGQ LAGDPPSPWS RRMKIDIHDL DEDLLTRAIE GRGIIEIVVN       120
     GTGKDGTPAC ATVPPVCRRL SES                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page