(data stored in ACNUC7421 zone)

EMBL: AP010803.PE186

AP010803.PE186       Location/Qualifiers
FT   CDS             194700..195389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01860"
FT                   /product="extensin-like protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95020"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD8"
FT                   /protein_id="BAI95020.1"
FT                   /translation="MIERVWGNAILRGTGLAALTAAVLAGCGGDLVPRGRVERPAKPVR
FT                   TARPAAPPPMELRQCMAKLTSQSVLFTPLPDQNFGGGCSATGSVKLIDIGVPATNLGAM
FT                   TCGLAANFAAWARYGVQPAARLILGAEVERIETFGTYNCRPIAGSGKLSEHAHSNAVDV
FT                   SAFVLSDGRRISIQNDWNGDRRVRQFLEIIHASACKRFRTVLSPDYNAAHHDHFHFDMG
FT                   GRGGFCR"
     MIERVWGNAI LRGTGLAALT AAVLAGCGGD LVPRGRVERP AKPVRTARPA APPPMELRQC        60
     MAKLTSQSVL FTPLPDQNFG GGCSATGSVK LIDIGVPATN LGAMTCGLAA NFAAWARYGV       120
     QPAARLILGA EVERIETFGT YNCRPIAGSG KLSEHAHSNA VDVSAFVLSD GRRISIQNDW       180
     NGDRRVRQFL EIIHASACKR FRTVLSPDYN AAHHDHFHFD MGGRGGFCR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page