(data stored in ACNUC7421 zone)

EMBL: AP010803.PE187

AP010803.PE187       Location/Qualifiers
FT   CDS             195466..196344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01870"
FT                   /product="putative nucleotide-binding protein"
FT                   /note="putative Rossmann fold nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95021"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD9"
FT                   /protein_id="BAI95021.1"
FT                   /translation="MTRKEIEERKFRPASQEAADARLRTETPQTSSAAYRLAFQDTEFL
FT                   LREDLRPVRFQLELLKPQLLMDEAKIESTFVFYGSARIPEPEQVQARIDAATTPEQKRI
FT                   AENLGRKARYYEEARKLARISAQYPVNEAGCRHFVVCSGGGPSIMEAANRGAADVGQTT
FT                   IGMNIVLPHEQSPNRFVTPELSFQFHYFALRKMHFLLRARALAVFPGGFGTFDEMFELL
FT                   TLIQTGKMKPIPVLLFGREFWTRVVDFEALADEGVISPSDLNLLTWVETAEDAWEAVQR
FT                   FYEDSEAPGCG"
     MTRKEIEERK FRPASQEAAD ARLRTETPQT SSAAYRLAFQ DTEFLLREDL RPVRFQLELL        60
     KPQLLMDEAK IESTFVFYGS ARIPEPEQVQ ARIDAATTPE QKRIAENLGR KARYYEEARK       120
     LARISAQYPV NEAGCRHFVV CSGGGPSIME AANRGAADVG QTTIGMNIVL PHEQSPNRFV       180
     TPELSFQFHY FALRKMHFLL RARALAVFPG GFGTFDEMFE LLTLIQTGKM KPIPVLLFGR       240
     EFWTRVVDFE ALADEGVISP SDLNLLTWVE TAEDAWEAVQ RFYEDSEAPG CG               292
//

If you have problems or comments...

PBIL Back to PBIL home page