(data stored in ACNUC7421 zone)

EMBL: AP010803.PE192

AP010803.PE192       Location/Qualifiers
FT   CDS             complement(200003..200581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01920"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95026"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE4"
FT                   /protein_id="BAI95026.1"
FT                   /translation="MMNMLTDSHDAVTADWAAALLDFWFNQVGEQGWWSHDPALDRTCQ
FT                   ARFRALWEEKRHLPAEEFLERADDALAAVLLFDQLPRNMFRGSAAAFSTDALARDVARG
FT                   AVAHGYDIQIGGAGRLFFYMPFQHSEALDDQKLSVSLFEGAGDAKSLAFAREHYAVIER
FT                   FGRFPHRNAALGRANAPGEEEAAEEGGGW"
     MMNMLTDSHD AVTADWAAAL LDFWFNQVGE QGWWSHDPAL DRTCQARFRA LWEEKRHLPA        60
     EEFLERADDA LAAVLLFDQL PRNMFRGSAA AFSTDALARD VARGAVAHGY DIQIGGAGRL       120
     FFYMPFQHSE ALDDQKLSVS LFEGAGDAKS LAFAREHYAV IERFGRFPHR NAALGRANAP       180
     GEEEAAEEGG GW                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page