(data stored in ACNUC7421 zone)

EMBL: AP010803.PE194

AP010803.PE194       Location/Qualifiers
FT   CDS             complement(202230..202457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01940"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95028"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE6"
FT                   /protein_id="BAI95028.1"
FT                   /translation="MIQPPEIIRVTKPRVSCDGSGEIPAALGHPRVFLEIDEHGYVDCG
FT                   YCDRRFVLAGSVADTPEIAGLPDIPSGASL"
     MIQPPEIIRV TKPRVSCDGS GEIPAALGHP RVFLEIDEHG YVDCGYCDRR FVLAGSVADT        60
     PEIAGLPDIP SGASL                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page