(data stored in ACNUC7421 zone)

EMBL: AP010803.PE198

AP010803.PE198       Location/Qualifiers
FT   CDS             complement(205253..206767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="SJA_C1-01980"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma54 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95032"
FT                   /db_xref="GOA:D4YXF0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF0"
FT                   /protein_id="BAI95032.1"
FT                   /translation="MTLAPRLDLRQSQSLVMTPQLQQAIKLLALSNLEIEAFVAGELEK
FT                   NPLLEAGGTDDFAPPADGVDRAAEQHDLRAETGDADQLIGQGLGAADSPLDVDYGAETF
FT                   IDDGPGDRMAGAIGSGGGMDMLSGGSGEAPDFDSFANPEQGLQEHLMDQARSALSGMDL
FT                   MIAAQLIGQIDEAGYLEANLLETAHGMGVPLYRIEQVLGVIHGFDPTGVGARSLSECLA
FT                   LQAKEADRYDPCMAKLLANLDLLARGALPQLRRICGVDEEDMADMIRELRGYDPKPGLR
FT                   FSSESAAPVTPDLFVRPTREGWAIEVNSATLPRVLINRTYYVELASGPQDRTSKAWLAD
FT                   CLASANWLVKALDQRQKTIVKVASEIVRQQEDFFRKGVEHLKPLTLKAVADAIQMHEST
FT                   VSRVTSNKYLSCPRGLYELKYFFTSGVAAAGGEGAVSAEAVKSHIKALIAAETADAILS
FT                   DDTLVDLLRAKGMDIARRTVAKYREAMGIGSSVQRRRQKALRGQAA"
     MTLAPRLDLR QSQSLVMTPQ LQQAIKLLAL SNLEIEAFVA GELEKNPLLE AGGTDDFAPP        60
     ADGVDRAAEQ HDLRAETGDA DQLIGQGLGA ADSPLDVDYG AETFIDDGPG DRMAGAIGSG       120
     GGMDMLSGGS GEAPDFDSFA NPEQGLQEHL MDQARSALSG MDLMIAAQLI GQIDEAGYLE       180
     ANLLETAHGM GVPLYRIEQV LGVIHGFDPT GVGARSLSEC LALQAKEADR YDPCMAKLLA       240
     NLDLLARGAL PQLRRICGVD EEDMADMIRE LRGYDPKPGL RFSSESAAPV TPDLFVRPTR       300
     EGWAIEVNSA TLPRVLINRT YYVELASGPQ DRTSKAWLAD CLASANWLVK ALDQRQKTIV       360
     KVASEIVRQQ EDFFRKGVEH LKPLTLKAVA DAIQMHESTV SRVTSNKYLS CPRGLYELKY       420
     FFTSGVAAAG GEGAVSAEAV KSHIKALIAA ETADAILSDD TLVDLLRAKG MDIARRTVAK       480
     YREAMGIGSS VQRRRQKALR GQAA                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page