(data stored in ACNUC7421 zone)

EMBL: AP010803.PE2

AP010803.PE2         Location/Qualifiers
FT   CDS             980..1573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00020"
FT                   /product="Maf-like protein"
FT                   /note="nucleotide-binding protein implicated in inhibition
FT                   of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94836"
FT                   /db_xref="GOA:D4YWV4"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV4"
FT                   /protein_id="BAI94836.1"
FT                   /translation="MIVLASQSASRRALLEAAQVPFEALSPGVDEEAAKEALRADGLDA
FT                   RQLADALAELKALRVSRRVPGALVLGCDQTLSLDDGAMIDKAVDRSDAERILKLLSGRV
FT                   HHLHSAAVIALNGEPIWRHIERVRMTVRPLSDAFIAHYLDGDWEQCRWCVGCYRIEGPG
FT                   AQLFSRVEGSQFAIQGLPLLPLLDFLRIRGVLES"
     MIVLASQSAS RRALLEAAQV PFEALSPGVD EEAAKEALRA DGLDARQLAD ALAELKALRV        60
     SRRVPGALVL GCDQTLSLDD GAMIDKAVDR SDAERILKLL SGRVHHLHSA AVIALNGEPI       120
     WRHIERVRMT VRPLSDAFIA HYLDGDWEQC RWCVGCYRIE GPGAQLFSRV EGSQFAIQGL       180
     PLLPLLDFLR IRGVLES                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page