(data stored in ACNUC7421 zone)

EMBL: AP010803.PE200

AP010803.PE200       Location/Qualifiers
FT   CDS             207644..207907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95034"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF2"
FT                   /protein_id="BAI95034.1"
FT                   /translation="MTPRGNWQALCMGTPPGQGENGVSDLFGAMIRDKIGVGAGAFNAR
FT                   PTGNKEGNAGAPNGEGLFRSEEMVRSRGTNSVFQHVSRKCRH"
     MTPRGNWQAL CMGTPPGQGE NGVSDLFGAM IRDKIGVGAG AFNARPTGNK EGNAGAPNGE        60
     GLFRSEEMVR SRGTNSVFQH VSRKCRH                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page