(data stored in ACNUC7421 zone)

EMBL: AP010803.PE201

AP010803.PE201       Location/Qualifiers
FT   CDS             complement(207959..210058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02010"
FT                   /product="alcohol dehydrogenase large subunit"
FT                   /EC_number="1.1.2.-"
FT                   /note="uncharacterized proteins of WD40-like repeat family
FT                   / glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95035"
FT                   /db_xref="GOA:D4YXF3"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF3"
FT                   /protein_id="BAI95035.1"
FT                   /translation="MNRIIRIIILTGAGAPLLAATVAGVHPGAVDDARMIAAASEPANW
FT                   LVNGGTFNGDHYSKLDQINVNTVKDLKPAWSFDFDTVRGQQSEPLVVDGVMYVSTSWSK
FT                   VYALDAATGRQIWFFDPMVPGDTGVKVCCDTVNRGVAVYKGKVYVGTLDGRLIAISART
FT                   GTQLWSTRTVDPKSALTITGAPRVIHDKVIIGNAGADFGVRGYVSAYDAATGKLVWRFY
FT                   TVPGDPAKGPDHAASDEIMEKLVRPTWSGDYAKYGGGGTAWHAISYDPELNQLYIGTGN
FT                   GSPWNPKYRTAGKGDNLFLCSVIALDPDTGKYIWHYQENPQEAWDYNSSQPMILGNLTI
FT                   DGKIRKVLMHAPKNGFFYVLDRTNGKVISAKPYVPVTWASGIDTVTGRPIETPNSRYTD
FT                   GPFHLRPNSSGAHNWHAMAYSPKTGLVYLNAFENSAEVRDDPNFKTYTRGPFNTGLLSK
FT                   LKGGPTHLLAWNPVTQTEAWRVPADRAGVLATAGGLVFQGQGAVTGRFTAFRADNGREV
FT                   WNYKMPNGVQAGPIAYSVRGVQYVAIATGNGASPAAGDADERERQPGRMVAFRLNGTAK
FT                   LPAEPGAPPPPNPTADPFTDKQIAQGGTNYGRYCSRCHGPAAISSNVIPDLRRSAFLSD
FT                   RQSWRAVVIDGALEGNGMVGWKQHLDEAEAEEIRGYVSAQAVALKKRGSGAATSRPPES
FT                   ASPEQ"
     MNRIIRIIIL TGAGAPLLAA TVAGVHPGAV DDARMIAAAS EPANWLVNGG TFNGDHYSKL        60
     DQINVNTVKD LKPAWSFDFD TVRGQQSEPL VVDGVMYVST SWSKVYALDA ATGRQIWFFD       120
     PMVPGDTGVK VCCDTVNRGV AVYKGKVYVG TLDGRLIAIS ARTGTQLWST RTVDPKSALT       180
     ITGAPRVIHD KVIIGNAGAD FGVRGYVSAY DAATGKLVWR FYTVPGDPAK GPDHAASDEI       240
     MEKLVRPTWS GDYAKYGGGG TAWHAISYDP ELNQLYIGTG NGSPWNPKYR TAGKGDNLFL       300
     CSVIALDPDT GKYIWHYQEN PQEAWDYNSS QPMILGNLTI DGKIRKVLMH APKNGFFYVL       360
     DRTNGKVISA KPYVPVTWAS GIDTVTGRPI ETPNSRYTDG PFHLRPNSSG AHNWHAMAYS       420
     PKTGLVYLNA FENSAEVRDD PNFKTYTRGP FNTGLLSKLK GGPTHLLAWN PVTQTEAWRV       480
     PADRAGVLAT AGGLVFQGQG AVTGRFTAFR ADNGREVWNY KMPNGVQAGP IAYSVRGVQY       540
     VAIATGNGAS PAAGDADERE RQPGRMVAFR LNGTAKLPAE PGAPPPPNPT ADPFTDKQIA       600
     QGGTNYGRYC SRCHGPAAIS SNVIPDLRRS AFLSDRQSWR AVVIDGALEG NGMVGWKQHL       660
     DEAEAEEIRG YVSAQAVALK KRGSGAATSR PPESASPEQ                              699
//

If you have problems or comments...

PBIL Back to PBIL home page