(data stored in ACNUC7421 zone)

EMBL: AP010803.PE202

AP010803.PE202       Location/Qualifiers
FT   CDS             complement(210147..210668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95036"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXF4"
FT                   /protein_id="BAI95036.1"
FT                   /translation="MSAEAIHLLIAAETPPPAAGETALTGRARVGGGRGEGAPVTRMLL
FT                   SPHPIAAPPVEGEIRWSGARVARVGLVEIANATALLCNFLEVADEAEEEFNAWYDTEHL
FT                   PRLGALPGVSGIARYRSDASPRYLALFTLAGSDIPAGEAWRTAARTPWTARIKRFTRGY
FT                   HSFLFTPASL"
     MSAEAIHLLI AAETPPPAAG ETALTGRARV GGGRGEGAPV TRMLLSPHPI AAPPVEGEIR        60
     WSGARVARVG LVEIANATAL LCNFLEVADE AEEEFNAWYD TEHLPRLGAL PGVSGIARYR       120
     SDASPRYLAL FTLAGSDIPA GEAWRTAART PWTARIKRFT RGYHSFLFTP ASL              173
//

If you have problems or comments...

PBIL Back to PBIL home page