(data stored in ACNUC7421 zone)

EMBL: AP010803.PE208

AP010803.PE208       Location/Qualifiers
FT   CDS             217367..217792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02080"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /note="Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95042"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG0"
FT                   /protein_id="BAI95042.1"
FT                   /translation="MTDSTPLSEFRPVRSGLMTGALDDLASVGLAGSRCRACGETTLGA
FT                   NTLCPNCGSDDVFPIALSDEGKVWTYTVVRYRPPGDYKGAEPFQPFAIGLVELPEGLRV
FT                   VAPVGGDPDAVRIGMTVRFTARARADGVVDFVYNPAA"
     MTDSTPLSEF RPVRSGLMTG ALDDLASVGL AGSRCRACGE TTLGANTLCP NCGSDDVFPI        60
     ALSDEGKVWT YTVVRYRPPG DYKGAEPFQP FAIGLVELPE GLRVVAPVGG DPDAVRIGMT       120
     VRFTARARAD GVVDFVYNPA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page