(data stored in ACNUC7421 zone)

EMBL: AP010803.PE212

AP010803.PE212       Location/Qualifiers
FT   CDS             complement(221835..222623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02120"
FT                   /product="conserved hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95046"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG4"
FT                   /protein_id="BAI95046.1"
FT                   /translation="MGVNNMRHGMERRTLIGGALATGLAGALPGRLLAAAPDGRLFKCT
FT                   EFLRRAPGMTPDAFLAHWEKERAPLLLGLKGLRGLIFNRVIRERSPDAPHDGIIEMWFA
FT                   DEAAYTHAFGAADEQLIGALADDLPHFAAGDPMGLFTREVSIRIPNSKPGNAKRIGLVG
FT                   RNPGTTEDQFFREWRTVHAKEAANQPGLAGYVLNMRAGPRLPDLPWDGYAQLWWTDWPA
FT                   FEAASRAIHATVGARLHFFHAHQLYYVDEFVALALQGRFG"
     MGVNNMRHGM ERRTLIGGAL ATGLAGALPG RLLAAAPDGR LFKCTEFLRR APGMTPDAFL        60
     AHWEKERAPL LLGLKGLRGL IFNRVIRERS PDAPHDGIIE MWFADEAAYT HAFGAADEQL       120
     IGALADDLPH FAAGDPMGLF TREVSIRIPN SKPGNAKRIG LVGRNPGTTE DQFFREWRTV       180
     HAKEAANQPG LAGYVLNMRA GPRLPDLPWD GYAQLWWTDW PAFEAASRAI HATVGARLHF       240
     FHAHQLYYVD EFVALALQGR FG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page