(data stored in ACNUC7421 zone)

EMBL: AP010803.PE215

AP010803.PE215       Location/Qualifiers
FT   CDS             226162..226983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02150"
FT                   /product="conserved hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95049"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG7"
FT                   /protein_id="BAI95049.1"
FT                   /translation="MSEQPANTRPGAVIGRRELLAAGVAALTVPAMARAQYTRMPPGIA
FT                   KSLTLLIRKPGATHEEFMRYWLGVHAPMALKIPGMRGMVCNEVLGPSRGRNDIPGGTPI
FT                   LIDGVAESWKLESNSPSNPDAPPEARAWYSDGPLFVGEIQGYRVTENVMVPVKRGGKGL
FT                   FSLLQRKPGTTHAAFVDHWLRVHGAMASKVPEVAGLILNEVVAPARRSDIPPFSHALGE
FT                   VDGIAQSWHKDQSYRGVTSPEAKAWYADGAASIGFARGYYTQEHVVIDPHP"
     MSEQPANTRP GAVIGRRELL AAGVAALTVP AMARAQYTRM PPGIAKSLTL LIRKPGATHE        60
     EFMRYWLGVH APMALKIPGM RGMVCNEVLG PSRGRNDIPG GTPILIDGVA ESWKLESNSP       120
     SNPDAPPEAR AWYSDGPLFV GEIQGYRVTE NVMVPVKRGG KGLFSLLQRK PGTTHAAFVD       180
     HWLRVHGAMA SKVPEVAGLI LNEVVAPARR SDIPPFSHAL GEVDGIAQSW HKDQSYRGVT       240
     SPEAKAWYAD GAASIGFARG YYTQEHVVID PHP                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page