(data stored in ACNUC7421 zone)

EMBL: AP010803.PE217

AP010803.PE217       Location/Qualifiers
FT   CDS             227980..230805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02170"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95051"
FT                   /db_xref="GOA:D4YXG9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXG9"
FT                   /protein_id="BAI95051.1"
FT                   /translation="MRPWRLLNTSSLVPLAATGSLALATAAQAQGAPAQGAPAQAAAQP
FT                   TASDIVVTGTRISGFTAPTPVTAISQAQLQEKAVHTVSELLQDIPQLRINQNVGKSSEP
FT                   VGASTADLRGLGPQRTLVLLDGRRLPLTDPAGTIDTNVIPTALISNVEIVTGGASAAYG
FT                   SDAVAGVVNFTLERNLEGFRGDLSYAQTKYDDFHRPAVSLAYGHGFMDDRLHVEAAFDY
FT                   LRNSGQTSQASRPWGSHRTALLTNPNYTATNGQPRLIIADNSTFSQMTPGGVLGRTSGL
FT                   ALARLLGFPTGTGVQFGPNGQPVPFNYGTNVGGTYMTGGDGGSFEDGGNLLPILKRYTG
FT                   YGRIDFDLTQDIKLFGDYLESRTETRSDLTANYDNGTLTINADNAYLPAALRSAMAAAN
FT                   MSSFALGRQQLEDGTAFFSTRTTMRRGAIGIEGKFGGWSWDVSGQIGSTHYRQDSTNNR
FT                   IQTRFFNAVDAVINPATGQPVCRVTLQNPGSSNPDISGCVPVNLFGAGAINQAAQAYYL
FT                   GNSWQSSVQREKVFYLNLKGSPFTTWAGDVSLAAGAEYRTEQTVLTSDPDSAAARWRSI
FT                   NAQPFSGKYNVKEVYGEVVVPLARDMAFAKNLELNGAVRYTDYSTSGGVATWKVGLNYA
FT                   PVSDIRFRGTISRDIRAPNNYELFSRGNQVISQLVDRPSNVSGQVLQVTSGNPDLKPEK
FT                   ADTRAIGAVFQPGWLPGFRMSVDYYSIKIKDAISTVSGQNIVDFCFNGQTVYCASVVRD
FT                   ASGRLTRVNVVPFNAQSQKTSGIDFEAMYRFPLRTFGEGTMTFRVLANYVAELKTIANG
FT                   ATNDYVGLAGVSPPPLGVPQWRFNAEARYQIGRAKLGVTYSFIDGGKYDTRFNVTTLDI
FT                   DNNNIPSRGYVDLDASYKLTGNFDIYGRIDNLFNVAPPIAPNAIVQPQIANSPFYDTRG
FT                   MFWTLGVRARF"
     MRPWRLLNTS SLVPLAATGS LALATAAQAQ GAPAQGAPAQ AAAQPTASDI VVTGTRISGF        60
     TAPTPVTAIS QAQLQEKAVH TVSELLQDIP QLRINQNVGK SSEPVGASTA DLRGLGPQRT       120
     LVLLDGRRLP LTDPAGTIDT NVIPTALISN VEIVTGGASA AYGSDAVAGV VNFTLERNLE       180
     GFRGDLSYAQ TKYDDFHRPA VSLAYGHGFM DDRLHVEAAF DYLRNSGQTS QASRPWGSHR       240
     TALLTNPNYT ATNGQPRLII ADNSTFSQMT PGGVLGRTSG LALARLLGFP TGTGVQFGPN       300
     GQPVPFNYGT NVGGTYMTGG DGGSFEDGGN LLPILKRYTG YGRIDFDLTQ DIKLFGDYLE       360
     SRTETRSDLT ANYDNGTLTI NADNAYLPAA LRSAMAAANM SSFALGRQQL EDGTAFFSTR       420
     TTMRRGAIGI EGKFGGWSWD VSGQIGSTHY RQDSTNNRIQ TRFFNAVDAV INPATGQPVC       480
     RVTLQNPGSS NPDISGCVPV NLFGAGAINQ AAQAYYLGNS WQSSVQREKV FYLNLKGSPF       540
     TTWAGDVSLA AGAEYRTEQT VLTSDPDSAA ARWRSINAQP FSGKYNVKEV YGEVVVPLAR       600
     DMAFAKNLEL NGAVRYTDYS TSGGVATWKV GLNYAPVSDI RFRGTISRDI RAPNNYELFS       660
     RGNQVISQLV DRPSNVSGQV LQVTSGNPDL KPEKADTRAI GAVFQPGWLP GFRMSVDYYS       720
     IKIKDAISTV SGQNIVDFCF NGQTVYCASV VRDASGRLTR VNVVPFNAQS QKTSGIDFEA       780
     MYRFPLRTFG EGTMTFRVLA NYVAELKTIA NGATNDYVGL AGVSPPPLGV PQWRFNAEAR       840
     YQIGRAKLGV TYSFIDGGKY DTRFNVTTLD IDNNNIPSRG YVDLDASYKL TGNFDIYGRI       900
     DNLFNVAPPI APNAIVQPQI ANSPFYDTRG MFWTLGVRAR F                           941
//

If you have problems or comments...

PBIL Back to PBIL home page