(data stored in ACNUC7421 zone)

EMBL: AP010803.PE218

AP010803.PE218       Location/Qualifiers
FT   CDS             complement(230815..231306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95052"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH0"
FT                   /protein_id="BAI95052.1"
FT                   /translation="MTATPPADPRFAANAIPCDGCTLCCFNEQVILRPEAGDVLDDFDW
FT                   EYIASDLYPGQRVPALKRDPATGHCVYLTETGCSIHERAPAICRRYHCARTFKALGRMS
FT                   RCRRDILWAMGNVLDRAQVERGRDRLQRARELGIDHLIDTDAQVRAFERIADAHKSGRR
FT                   "
     MTATPPADPR FAANAIPCDG CTLCCFNEQV ILRPEAGDVL DDFDWEYIAS DLYPGQRVPA        60
     LKRDPATGHC VYLTETGCSI HERAPAICRR YHCARTFKAL GRMSRCRRDI LWAMGNVLDR       120
     AQVERGRDRL QRARELGIDH LIDTDAQVRA FERIADAHKS GRR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page