(data stored in ACNUC7421 zone)

EMBL: AP010803.PE219

AP010803.PE219       Location/Qualifiers
FT   CDS             complement(231413..232366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95053"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH1"
FT                   /protein_id="BAI95053.1"
FT                   /translation="MRRARWMGLAVAAGLLGAAAPPPPPPPPEIAIPQPRVFPESITAT
FT                   RDGTLIVGSAGNGTIWRARPGDKAATIFIAPDSSGLVSVLGVFADDRHGLLYVCSNGRR
FT                   GDPTEARDRAAAIRLFDLKSGAPVRNIPTPGASRSLCNDFAVAPDGTAYVAETLRGSII
FT                   RVRGDKADVWIADPRLAGADGIAFDNDGQLYVTSVTSGRMFRTGASADGSARPLVELIP
FT                   PRKLDRPDGLRHIGPGRFLLAEAGDEGGITLMTVKGDMVTLSPLPGGRAGTTSAVALGK
FT                   TSWAVAGKLRYRTDPALAGQDPGPFAIYGTPIRAGR"
     MRRARWMGLA VAAGLLGAAA PPPPPPPPEI AIPQPRVFPE SITATRDGTL IVGSAGNGTI        60
     WRARPGDKAA TIFIAPDSSG LVSVLGVFAD DRHGLLYVCS NGRRGDPTEA RDRAAAIRLF       120
     DLKSGAPVRN IPTPGASRSL CNDFAVAPDG TAYVAETLRG SIIRVRGDKA DVWIADPRLA       180
     GADGIAFDND GQLYVTSVTS GRMFRTGASA DGSARPLVEL IPPRKLDRPD GLRHIGPGRF       240
     LLAEAGDEGG ITLMTVKGDM VTLSPLPGGR AGTTSAVALG KTSWAVAGKL RYRTDPALAG       300
     QDPGPFAIYG TPIRAGR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page