(data stored in SCRATCH zone)

EMBL: AP010803.PE220

AP010803.PE220       Location/Qualifiers
FT   CDS             complement(232383..232925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95054"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH2"
FT                   /protein_id="BAI95054.1"
FT                   /translation="MSLGLVFVMGAPDAGADGLSLPEGALAPVPWVGRTMSSRAGEPGR
FT                   PRHMLLADSAAKTDLAGAAGAWRWSGVQILPGDEPAPRNAGGLLVNWMNIDGAHEEEFN
FT                   DWYDTEHVPRFRAVDGVLAARRFRASTGQPSYAAFYHLRDLDVVTGAQWREAATTPWSA
FT                   RILTFRHDNLRMGFTPA"
     MSLGLVFVMG APDAGADGLS LPEGALAPVP WVGRTMSSRA GEPGRPRHML LADSAAKTDL        60
     AGAAGAWRWS GVQILPGDEP APRNAGGLLV NWMNIDGAHE EEFNDWYDTE HVPRFRAVDG       120
     VLAARRFRAS TGQPSYAAFY HLRDLDVVTG AQWREAATTP WSARILTFRH DNLRMGFTPA       180
//

If you have problems or comments...

PBIL Back to PBIL home page