(data stored in SCRATCH zone)

EMBL: AP010803.PE223

AP010803.PE223       Location/Qualifiers
FT   CDS             complement(234304..235254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02230"
FT                   /product="putative extradiol ring-cleavage dioxygenase"
FT                   /note="putative extradiol ring-cleavage dioxygenase, class
FT                   III enzyme, subunit B / protocatechuate 3,4-dioxygenase
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95057"
FT                   /db_xref="GOA:D4YXH5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXH5"
FT                   /protein_id="BAI95057.1"
FT                   /translation="MLNMRDGDWARFEERDIPGKFLDKEGRPATYAMLLERADKALRDH
FT                   ITPALLDERMRAAKRGVERIRAAIVASGIDTLIVIGDDQAELYTNDNLPSILIYYGETI
FT                   RNNPRHKGNPNPLEWWQNARGGYYVDEGETDFPVDAGLARHMIARLVDDEFDISTANRL
FT                   RDGEGEGHAFGFVHRQLMDEANPLPIVPLALNTYYAPNQPTPRRCYALGQAIRRAVESY
FT                   PEDIKVGVIASGGLSHFVVDEELDRGLIEAIRAKDVAALTSMDRAKLNSGSSEIRNWIA
FT                   TAGACEHLDLAWSEYLPCYRTEAGTGTGVCFAEWH"
     MLNMRDGDWA RFEERDIPGK FLDKEGRPAT YAMLLERADK ALRDHITPAL LDERMRAAKR        60
     GVERIRAAIV ASGIDTLIVI GDDQAELYTN DNLPSILIYY GETIRNNPRH KGNPNPLEWW       120
     QNARGGYYVD EGETDFPVDA GLARHMIARL VDDEFDISTA NRLRDGEGEG HAFGFVHRQL       180
     MDEANPLPIV PLALNTYYAP NQPTPRRCYA LGQAIRRAVE SYPEDIKVGV IASGGLSHFV       240
     VDEELDRGLI EAIRAKDVAA LTSMDRAKLN SGSSEIRNWI ATAGACEHLD LAWSEYLPCY       300
     RTEAGTGTGV CFAEWH                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page