(data stored in ACNUC7421 zone)

EMBL: AP010803.PE228

AP010803.PE228       Location/Qualifiers
FT   CDS             239623..240216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02280"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95062"
FT                   /db_xref="GOA:D4YXI0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXI0"
FT                   /protein_id="BAI95062.1"
FT                   /translation="MPRIPFPEFATMNPAQRAVYEAIVSGPRGGLVGPLRAALHNPELA
FT                   DKWQRFGELLRFRTSLTKRHSELAILVTARVWNCSFEWFQHEPHALAAGLPAGIVNALR
FT                   MEQRPDFDDSADEAIYEFTNQLQRDHSVTDAAHRAVQAVYGVTGVVELTALIGYYALVA
FT                   MTLNAHAFDLPEGATDPFAGQAGTDAAAIHPSTE"
     MPRIPFPEFA TMNPAQRAVY EAIVSGPRGG LVGPLRAALH NPELADKWQR FGELLRFRTS        60
     LTKRHSELAI LVTARVWNCS FEWFQHEPHA LAAGLPAGIV NALRMEQRPD FDDSADEAIY       120
     EFTNQLQRDH SVTDAAHRAV QAVYGVTGVV ELTALIGYYA LVAMTLNAHA FDLPEGATDP       180
     FAGQAGTDAA AIHPSTE                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page