(data stored in ACNUC7421 zone)

EMBL: AP010803.PE239

AP010803.PE239       Location/Qualifiers
FT   CDS             252291..252785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95073"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ1"
FT                   /protein_id="BAI95073.1"
FT                   /translation="MEEGSPMSARFWLFSCACAGAALTGGFGLGLYATTPPRFGTETVL
FT                   PQAVSPDGADYDMMSANLAGPAVVRCDGCGPTLADRQMAADMAGWDGMNDPVVRDYAAQ
FT                   DDGMTPDHAEPPPPVRMLPASIERFADGEGEGSFQPVRIARAPDSGTSAEEAPADAAMS
FT                   Y"
     MEEGSPMSAR FWLFSCACAG AALTGGFGLG LYATTPPRFG TETVLPQAVS PDGADYDMMS        60
     ANLAGPAVVR CDGCGPTLAD RQMAADMAGW DGMNDPVVRD YAAQDDGMTP DHAEPPPPVR       120
     MLPASIERFA DGEGEGSFQP VRIARAPDSG TSAEEAPADA AMSY                        164
//

If you have problems or comments...

PBIL Back to PBIL home page