(data stored in ACNUC7421 zone)

EMBL: AP010803.PE241

AP010803.PE241       Location/Qualifiers
FT   CDS             complement(257344..257931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95075"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ3"
FT                   /protein_id="BAI95075.1"
FT                   /translation="MIACLIMLAAASTAAQSSATQIAQATFQPERAIADALAQWDAQFD
FT                   AGVTRASVGRTMTADQEARKNRAKAAGKAELSQQLRTTGIPKMLHLIEADYIQNFSEEE
FT                   LREAAIFWTSPAGQAFTAAMQEAVKNGTGRIVPPAQHAAAINRYMTSATGRKESVRSGI
FT                   LRPVLAKEMGLFMQQAQPKIDARMRAAMSAAS"
     MIACLIMLAA ASTAAQSSAT QIAQATFQPE RAIADALAQW DAQFDAGVTR ASVGRTMTAD        60
     QEARKNRAKA AGKAELSQQL RTTGIPKMLH LIEADYIQNF SEEELREAAI FWTSPAGQAF       120
     TAAMQEAVKN GTGRIVPPAQ HAAAINRYMT SATGRKESVR SGILRPVLAK EMGLFMQQAQ       180
     PKIDARMRAA MSAAS                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page