(data stored in SCRATCH zone)

EMBL: AP010803.PE245

AP010803.PE245       Location/Qualifiers
FT   CDS             complement(261653..262384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02450"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95079"
FT                   /db_xref="GOA:D4YXJ7"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ7"
FT                   /protein_id="BAI95079.1"
FT                   /translation="MAERPWRAGCEGWFDVLSASGETNGIIFSVRPGGRGWWHCVFTFA
FT                   RPGQTPMEAFFTSTALVALAEMGDKTQLLAMLLATRFRKPVPIILGILAATLANHFLAA
FT                   LVGHSVAGALTQPWFRYAVAASFIAMAVWTLIPDKFDEDEPLKAPSRAGVFMTTLIAFF
FT                   LVEMGDKTQVATVMLGARFDNILAVTAGTTLGMMIANVPAVLFGGALARKVPMRALQVG
FT                   AALLFLALGLWMIADLRGWIG"
     MAERPWRAGC EGWFDVLSAS GETNGIIFSV RPGGRGWWHC VFTFARPGQT PMEAFFTSTA        60
     LVALAEMGDK TQLLAMLLAT RFRKPVPIIL GILAATLANH FLAALVGHSV AGALTQPWFR       120
     YAVAASFIAM AVWTLIPDKF DEDEPLKAPS RAGVFMTTLI AFFLVEMGDK TQVATVMLGA       180
     RFDNILAVTA GTTLGMMIAN VPAVLFGGAL ARKVPMRALQ VGAALLFLAL GLWMIADLRG       240
     WIG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page