(data stored in ACNUC7421 zone)

EMBL: AP010803.PE247

AP010803.PE247       Location/Qualifiers
FT   CDS             complement(263492..263920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95081"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ9"
FT                   /protein_id="BAI95081.1"
FT                   /translation="MSDYAPEDAALLCAVGRLVCAWTMLEQSLEAKVAMMREAMGDVRT
FT                   VGARTRPGMTKLMTELRTMVSMRDRRNAGALMEIADIERDMQRIDRFRSLIIGGFQQPA
FT                   PGGFTCRDARNNQTHVSLEQLEAEIASLERVAQRLLAV"
     MSDYAPEDAA LLCAVGRLVC AWTMLEQSLE AKVAMMREAM GDVRTVGART RPGMTKLMTE        60
     LRTMVSMRDR RNAGALMEIA DIERDMQRID RFRSLIIGGF QQPAPGGFTC RDARNNQTHV       120
     SLEQLEAEIA SLERVAQRLL AV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page