(data stored in ACNUC7421 zone)

EMBL: AP010803.PE248

AP010803.PE248       Location/Qualifiers
FT   CDS             complement(264122..264295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02480"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95082"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK0"
FT                   /protein_id="BAI95082.1"
FT                   /translation="MGTFNGRRPAHVKPPAHLSKSPPVPQPDPIGSPSRHDEELSPVRY
FT                   GDWERKGIAIDF"
     MGTFNGRRPA HVKPPAHLSK SPPVPQPDPI GSPSRHDEEL SPVRYGDWER KGIAIDF           57
//

If you have problems or comments...

PBIL Back to PBIL home page