(data stored in SCRATCH zone)

EMBL: AP010803.PE252

AP010803.PE252       Location/Qualifiers
FT   CDS             complement(267892..268377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02520"
FT                   /product="PAS/PAC domain protein"
FT                   /note="FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95086"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK4"
FT                   /protein_id="BAI95086.1"
FT                   /translation="MRPTEPLPLNHSWPLYALRDHLAPVMLDDRIARDDGALAERGLGL
FT                   WHCDLGDDSLNWTDGVYDIFGLERGTAVPRPLAVSLYAPDSCAAMERLRAYAIRHRRGF
FT                   TVDVDIRPADGGECAMRLIAAPVIQRNRVVALHGVKQFLPKGSRPSTRLDPTLFILS"
     MRPTEPLPLN HSWPLYALRD HLAPVMLDDR IARDDGALAE RGLGLWHCDL GDDSLNWTDG        60
     VYDIFGLERG TAVPRPLAVS LYAPDSCAAM ERLRAYAIRH RRGFTVDVDI RPADGGECAM       120
     RLIAAPVIQR NRVVALHGVK QFLPKGSRPS TRLDPTLFIL S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page