(data stored in ACNUC7421 zone)

EMBL: AP010803.PE256

AP010803.PE256       Location/Qualifiers
FT   CDS             complement(271865..272254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02560"
FT                   /product="Iojap-related protein"
FT                   /note="uncharacterized homolog of plant Iojap protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95090"
FT                   /db_xref="GOA:D4YXK8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK8"
FT                   /protein_id="BAI95090.1"
FT                   /translation="MTRPHPANDTAHNADSVAALHDLVLKSLDDDQAQETISIPLEGKS
FT                   SIADHMVIASGRSSRQVASMAQKLAERIKQATGRSARVEGLPVADWVLIDAGDVIVHLF
FT                   RPEVRSFYNLERMWGFVDAPVAGTA"
     MTRPHPANDT AHNADSVAAL HDLVLKSLDD DQAQETISIP LEGKSSIADH MVIASGRSSR        60
     QVASMAQKLA ERIKQATGRS ARVEGLPVAD WVLIDAGDVI VHLFRPEVRS FYNLERMWGF       120
     VDAPVAGTA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page