(data stored in ACNUC7421 zone)

EMBL: AP010803.PE258

AP010803.PE258       Location/Qualifiers
FT   CDS             complement(273000..273689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95092"
FT                   /db_xref="GOA:D4YXL0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL0"
FT                   /protein_id="BAI95092.1"
FT                   /translation="MTDLLPPLASLGRLRRDAPKTVAGFRRWRAIIDTDGAVPAKVKRL
FT                   FVACAATMKGYRELATRELAEARAAGLTEAEAGAAIAILASVRGEGASLRFHDLFREIY
FT                   PEATDPDWPDDDMIVEDGAAQANFLQYFGAMPPSLGKLFEVKPLGADAYYLMREGTLSG
FT                   TALGPVYAELLLVTVLVADYSSWASVHMKGARTAGASEEAVAEAVICAVPTAGLSAWVI
FT                   GATAMDA"
     MTDLLPPLAS LGRLRRDAPK TVAGFRRWRA IIDTDGAVPA KVKRLFVACA ATMKGYRELA        60
     TRELAEARAA GLTEAEAGAA IAILASVRGE GASLRFHDLF REIYPEATDP DWPDDDMIVE       120
     DGAAQANFLQ YFGAMPPSLG KLFEVKPLGA DAYYLMREGT LSGTALGPVY AELLLVTVLV       180
     ADYSSWASVH MKGARTAGAS EEAVAEAVIC AVPTAGLSAW VIGATAMDA                   229
//

If you have problems or comments...

PBIL Back to PBIL home page