(data stored in ACNUC7421 zone)

EMBL: AP010803.PE259

AP010803.PE259       Location/Qualifiers
FT   CDS             273837..274745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02590"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95093"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL1"
FT                   /protein_id="BAI95093.1"
FT                   /translation="MREEQARMRDFKGRTAVITGAGSGIGAALAHLAAREGMNLVLADI
FT                   NLADLEAVAASIDSPAIALQRTDVADPEAVQALADLAWSRFGEVSLLCNNAGVVPGGRH
FT                   RLVWEYALEDWRWAFGVNMDGVVNGIRSFVPRMLAEGRPGHILNTASVAGFVSGEGSAV
FT                   YGASKHAVVRITEALYAGLRERNAPIGVTMLCPGLVATRIYEAERSRPAHLRSSDGRPA
FT                   EAAEFQSISDNLFQNAPSPEEVAAQAFDGIRNDQFYVFTTTRYDPVIAQRTQSILAREN
FT                   PLFDSLISLSKGKADAGEERS"
     MREEQARMRD FKGRTAVITG AGSGIGAALA HLAAREGMNL VLADINLADL EAVAASIDSP        60
     AIALQRTDVA DPEAVQALAD LAWSRFGEVS LLCNNAGVVP GGRHRLVWEY ALEDWRWAFG       120
     VNMDGVVNGI RSFVPRMLAE GRPGHILNTA SVAGFVSGEG SAVYGASKHA VVRITEALYA       180
     GLRERNAPIG VTMLCPGLVA TRIYEAERSR PAHLRSSDGR PAEAAEFQSI SDNLFQNAPS       240
     PEEVAAQAFD GIRNDQFYVF TTTRYDPVIA QRTQSILARE NPLFDSLISL SKGKADAGEE       300
     RS                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page