(data stored in SCRATCH zone)

EMBL: AP010803.PE26

AP010803.PE26        Location/Qualifiers
FT   CDS             complement(25771..26673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00260"
FT                   /product="ParB-like protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94860"
FT                   /db_xref="GOA:D4YWX8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWX8"
FT                   /protein_id="BAI94860.1"
FT                   /translation="MKSAKRPHGLGRGLSALLGDVAREEPVAPTAVAPPSTKAIQSIEV
FT                   ALIQPHPEQPRRHFDEGALQELADSIGKRGVIQPIIVRPHGGGFQIVAGERRWRAAQRA
FT                   QLHRIPAIVRDFDEAETLEIALIENIQREDLNPIEEAEAYRKLIAEFQHSQEALARLVG
FT                   KSRSHVANLMRLLDLPAPVQRQVIEQKLSMGHARALIGAPDCENLARTVEAKGLSVRDT
FT                   EQLVRRAKKGDGAPGRKRPAAARDDDPDIAALEQHLADILGVKVDIDYAQGGNGTLSLH
FT                   YSTLDQLDMLCQRLSGERI"
     MKSAKRPHGL GRGLSALLGD VAREEPVAPT AVAPPSTKAI QSIEVALIQP HPEQPRRHFD        60
     EGALQELADS IGKRGVIQPI IVRPHGGGFQ IVAGERRWRA AQRAQLHRIP AIVRDFDEAE       120
     TLEIALIENI QREDLNPIEE AEAYRKLIAE FQHSQEALAR LVGKSRSHVA NLMRLLDLPA       180
     PVQRQVIEQK LSMGHARALI GAPDCENLAR TVEAKGLSVR DTEQLVRRAK KGDGAPGRKR       240
     PAAARDDDPD IAALEQHLAD ILGVKVDIDY AQGGNGTLSL HYSTLDQLDM LCQRLSGERI       300
//

If you have problems or comments...

PBIL Back to PBIL home page