(data stored in ACNUC7421 zone)

EMBL: AP010803.PE260

AP010803.PE260       Location/Qualifiers
FT   CDS             274742..275494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02600"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95094"
FT                   /db_xref="GOA:D4YXL2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL2"
FT                   /protein_id="BAI95094.1"
FT                   /translation="MSRLQGRIALVTGAASGIGLATARRFAAEGATLILSDRNGDALSD
FT                   AAKSLPGDGHEVVVMDVTDEQAWIALADRVKTRFGTLDILVNNAGFGKFASIADTTLAQ
FT                   WRSIIAVNLDSVFLGTKYMMPLLAASGRGAIVNMSSIRGIVAGAGTGSYSAAKGGVRMF
FT                   TKATAIECAAAGNGVRANSIHPGHIATPLTAPAHADAEIARSLLADVPLGRIGQAEEIA
FT                   DGILFLASDESRYMTGAELVIDGGSTAQ"
     MSRLQGRIAL VTGAASGIGL ATARRFAAEG ATLILSDRNG DALSDAAKSL PGDGHEVVVM        60
     DVTDEQAWIA LADRVKTRFG TLDILVNNAG FGKFASIADT TLAQWRSIIA VNLDSVFLGT       120
     KYMMPLLAAS GRGAIVNMSS IRGIVAGAGT GSYSAAKGGV RMFTKATAIE CAAAGNGVRA       180
     NSIHPGHIAT PLTAPAHADA EIARSLLADV PLGRIGQAEE IADGILFLAS DESRYMTGAE       240
     LVIDGGSTAQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page