(data stored in ACNUC7421 zone)

EMBL: AP010803.PE262

AP010803.PE262       Location/Qualifiers
FT   CDS             276648..278087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02620"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95096"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL4"
FT                   /protein_id="BAI95096.1"
FT                   /translation="MSAGRSMPAMRPMLVLLPLLASTAGHAEPASFAAPEAPISQPGYG
FT                   EDLLPRDEKDRATLLRTVAFDATVYGMAAYLHYEQLYRQVFDRSSSNYTGFNRFAHERN
FT                   LAGPDYATFKVPNTDTLYSTAWIDLSKGPVEIDIPATQLKYFTLNIFDIFGNPSNLSNR
FT                   TIGVKGGRFLLVPRNWRGTAPAGVMVYPAATTQLWILMRAFAQSDAEVRTARAFQDAVR
FT                   IIAPEGEGPADSHGGASPPPPAPGAIGYFGALDHVLRANGWQPGEEALVSRFRPLGIGD
FT                   DRPFNPDRLTPATQAAIESGYAEALDMLTRAKSQLGEPTGTGWMKVNKGVYGFNYLRRS
FT                   VINMAGLGANVREENASYTTFADRNGSALDGASSRYMLRLQTPPPVNSFWSVTLYDAKT
FT                   FALHPNPLRRYLVSDRTKGLKVRKDGSIEIRIQHAASSDGNWLPAPAGPFFVVIRAYGP
FT                   KPDMLNGQWLPPPISREGDAR"
     MSAGRSMPAM RPMLVLLPLL ASTAGHAEPA SFAAPEAPIS QPGYGEDLLP RDEKDRATLL        60
     RTVAFDATVY GMAAYLHYEQ LYRQVFDRSS SNYTGFNRFA HERNLAGPDY ATFKVPNTDT       120
     LYSTAWIDLS KGPVEIDIPA TQLKYFTLNI FDIFGNPSNL SNRTIGVKGG RFLLVPRNWR       180
     GTAPAGVMVY PAATTQLWIL MRAFAQSDAE VRTARAFQDA VRIIAPEGEG PADSHGGASP       240
     PPPAPGAIGY FGALDHVLRA NGWQPGEEAL VSRFRPLGIG DDRPFNPDRL TPATQAAIES       300
     GYAEALDMLT RAKSQLGEPT GTGWMKVNKG VYGFNYLRRS VINMAGLGAN VREENASYTT       360
     FADRNGSALD GASSRYMLRL QTPPPVNSFW SVTLYDAKTF ALHPNPLRRY LVSDRTKGLK       420
     VRKDGSIEIR IQHAASSDGN WLPAPAGPFF VVIRAYGPKP DMLNGQWLPP PISREGDAR        479
//

If you have problems or comments...

PBIL Back to PBIL home page