(data stored in ACNUC7421 zone)

EMBL: AP010803.PE264

AP010803.PE264       Location/Qualifiers
FT   CDS             279335..280123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95098"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL6"
FT                   /protein_id="BAI95098.1"
FT                   /translation="MHLRRQARALAMRPGQLNFPLNPDYGTGSTIRRVSLRARPNRVDS
FT                   HLLDNFHEMRCSILHDASIVTAIAGQGIRLPTTACPGAIAQLQSLVGLPIGTPRRDFYT
FT                   GGIARRHCTHLLDLAVMAIGHAQGPSMEIVYEAEVPDEVELPVPITIRRNGRLVCRWLV
FT                   RQGAILDPLELRGRPLGAGFAAWASRAFEQGRLEAATILARTWLIAIGRRYRPSQVAGR
FT                   PARDNPEMLGRCYAYSAGQMETAAMTGEEEVHLHHPQREA"
     MHLRRQARAL AMRPGQLNFP LNPDYGTGST IRRVSLRARP NRVDSHLLDN FHEMRCSILH        60
     DASIVTAIAG QGIRLPTTAC PGAIAQLQSL VGLPIGTPRR DFYTGGIARR HCTHLLDLAV       120
     MAIGHAQGPS MEIVYEAEVP DEVELPVPIT IRRNGRLVCR WLVRQGAILD PLELRGRPLG       180
     AGFAAWASRA FEQGRLEAAT ILARTWLIAI GRRYRPSQVA GRPARDNPEM LGRCYAYSAG       240
     QMETAAMTGE EEVHLHHPQR EA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page