(data stored in ACNUC7421 zone)

EMBL: AP010803.PE282

AP010803.PE282       Location/Qualifiers
FT   CDS             298599..299021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95116"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN4"
FT                   /protein_id="BAI95116.1"
FT                   /translation="MGAHIVVPIPVHQTDSTLCRIPPPFRGPNLPDLILCSVNPPPMDL
FT                   GFLRTSGLKAGFVKPSGRRRVPVWPSLRAASAAAQAASPTALAVAGVLRGQEIEGDWVQ
FT                   ELADILAPRSGGNIEAVGLAGSFNPLIANLLKVGQG"
     MGAHIVVPIP VHQTDSTLCR IPPPFRGPNL PDLILCSVNP PPMDLGFLRT SGLKAGFVKP        60
     SGRRRVPVWP SLRAASAAAQ AASPTALAVA GVLRGQEIEG DWVQELADIL APRSGGNIEA       120
     VGLAGSFNPL IANLLKVGQG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page